PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 15409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 244aa    MW: 26882.9 Da    PI: 7.2766
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
15409genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.33.2e-16100134135
   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
            C+ C+t kTplWR+gp g ktLCnaCG++++  ++
  15409 100 CACCRTQKTPLWRNGPTGAKTLCNACGVRFKAGRV 134
            999****************************8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.7E-1294155IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-1294136No hitNo description
PROSITE profilePS5011413.08694130IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.4E-1495132IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.86E-1299136No hitNo description
PfamPF003208.0E-14100134IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGDVRFVARE DRTAFAKARP YAYASEMFEN VRHVGHDLKV EDGGAWRRPT YESIVAAQGR  60
GERRERDSSV ESDHTTQSDA CARKVVVEDD GPSPEAGVTC ACCRTQKTPL WRNGPTGAKT  120
LCNACGVRFK AGRVVCDEDG NVVTLAPQSR KRSLSVDHHE RGRQLNKSNY AALHKRIKPS  180
HSSFAYTHLS DARMIELQRV GDRGAKAPFP RVHSATILTD YDGAVLLMLL HDGEESEGES  240
DED*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005850.0CP000585.1 Ostreococcus lucimarinus CCE9901 chromosome 5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001417744.10.0predicted protein
TrEMBLA4RXG30.0A4RXG3_
STRINGA4RXG30.0(Ostreococcus lucimarinus CCE9901)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP633544
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-13GATA transcription factor 7